Click and see our every day special $2.00 per residue
1-800-301-6268 | My Account | Track Your Order | Logout  
 

Peptide List

We know that the success of your research requires the highest-quality reagents. Peptide 2.0 Inc provides the highest-quality peptides and superior customer service. We provides hundreds of catalogue peptides at the same level of quality as our customized products. We strive to be more than just a peptide supplier and our return business and frequent mentions in published research show that we have succeeded in our aims. Our goal is to help you achieve the best results by providing the highest-quality peptides with the best service available.


1001) : Angiotensin Converting Enzyme Inhibitor
Glp-Trp-Pro-Arg-Pro-Gln-Ile-Pro-Pro-OH (trifluoroacetate salt)
Nonapeptide capable of inhibiting the conversion of angiotensin I to angiotensin II, in vitro and in vivo. Bradykinin Potentiator.

SEQUENCE: Glp-Trp-Pro-Arg-Pro-Gln-Ile-Pro-Pro-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: Glp-WPRPQIPP

MOLECULAR FORMULA: C53H76N14O12

MOLECULAR WEIGHT: 1101.3

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [35115-60-7]

SYNONYMS:

RESEARCH AREA: Cardiovascular, Hormonal

CATEGORY: ACE Inhibitors »

REFERENCES:
M.A. Ondetti et al., Biochemistry, 10, 4033 (1971)
H.S. Cheung and D.W. Cushman, Biochim. Biophys. Acta, 293, 451 (1973)
L.C. Martin et al., Biochem. J., 184, 713 (1979)
D.I. Marlborough et al., Arch. Biochem. Biophys., 210, 43 (1981)
1002) : Angiotensin I Converting Enzyme Inhibitor 1
Glp-Gly-Leu-Pro-Pro-Arg-Pro-Lys-Ile-Pro-Pro-OH (trifluoroacetate salt)
Angiotensin I-converting enzyme inhibitor. Bradykinin Potentiator B.

SEQUENCE: Glp-Gly-Leu-Pro-Pro-Arg-Pro-Lys-Ile-Pro-Pro-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: Glp-GLPPRPKIPP

MOLECULAR FORMULA: C56H91N15O13

MOLECULAR WEIGHT: 1182.4

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS:

RESEARCH AREA: Cardiovascular, Hormonal

CATEGORY: ACE Inhibitors »

REFERENCES:
H. Kato et al., Biochemistry, 10, 972 (1971)
1003) : Angiotensin I Converting Enzyme Inhibitor 2
Glp-Gly-Leu-Pro-Pro-Gly-Pro-Pro-Ile-Pro-Pro-OH (trifluoroacetate salt)
Angiotensin I-converting enzyme inhibitor. Bradykinin Potentiator C.

SEQUENCE: Glp-Gly-Leu-Pro-Pro-Gly-Pro-Pro-Ile-Pro-Pro-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: Glp-GLPPGPPIPP

MOLECULAR FORMULA: C51H77N11O13

MOLECULAR WEIGHT: 1052.3

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS:

RESEARCH AREA: Cardiovascular, Hormonal

CATEGORY: ACE Inhibitors »

REFERENCES:
H. Kato et al., Biochemistry, 10, 972 (1971)
1004) : Angiotensin I Converting Enzyme Inhibitor 3
H-Arg-Pro-Gly-Phe-Ser-Pro-Phe-Arg-OH (trifluoroacetate salt)
[Des-Pro2] Bradykinin.

SEQUENCE: H-Arg-Pro-Gly-Phe-Ser-Pro-Phe-Arg-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: RPGFSPFR

MOLECULAR FORMULA: C45H66N14O10

MOLECULAR WEIGHT: 963.1

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS:

RESEARCH AREA: Cardiovascular, Hormonal

CATEGORY: ACE Inhibitors »

REFERENCES:
M. Naruse et al., Chem. Pharm. Bull., 29, 3369 (1981)
1005) : Acetalin-1
Ac-Arg-Phe-Met-Trp-Met-Thr-NH2 (trifluoroacetate salt)
Acetylated enkephalins, also named Opioid Receptor Antagonist, high affinity for m and K3 opioid receptor, weak affinity for K1 receptors and no affinity for K2 receptors.

SEQUENCE: Ac-Arg-Phe-Met-Trp-Met-Thr-NH2 (trifluoroacetate salt)

ONE-LETTER SEQUENCE: Ac-RFMWMT-NH2

MOLECULAR FORMULA: C42H61N11O8S2

MOLECULAR WEIGHT: 912.15

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [152274-65-2]

SYNONYMS:

RESEARCH AREA: Pain

CATEGORY: Acetalin »

REFERENCES:
C.T.Dooley et al., Proc. Natl. Acad. Sci. USA, 90, 10811 (1993)
1006) : Acetalin-2
Ac-Arg-Phe-Met-Trp-Met-Arg-NH2 (trifluoroacetate salt)
Acetylated enkephalins, also named Opioid Receptor Antagonist, high affinity for m and K3 opioid receptor, weak affinity for K1 receptors and no affinity for K2 receptors.

SEQUENCE: Ac-Arg-Phe-Met-Trp-Met-Arg-NH2 (trifluoroacetate salt)

ONE-LETTER SEQUENCE: Ac-RFMWMR-NH2

MOLECULAR FORMULA: C44H66N14O7S2

MOLECULAR WEIGHT: 967.23

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [152274-66-3]

SYNONYMS:

RESEARCH AREA: Pain

CATEGORY: Acetalin »

REFERENCES:
C.T.Dooley et al., Proc. Natl. Acad. Sci. USA, 90, 10811 (1993)
1007) : Acetalin-3
Ac-Arg-Phe-Met-Trp-Met-Lys-NH2 (trifluoroacetate salt)
Acetylated enkephalins, also named Opioid Receptor Antagonist, high affinity for m and K3 opioid receptor, weak affinity for K1 receptors and no affinity for K2 receptors.

SEQUENCE: Ac-Arg-Phe-Met-Trp-Met-Lys-NH2 (trifluoroacetate salt)

ONE-LETTER SEQUENCE: Ac-RFMWMK-NH2

MOLECULAR FORMULA: C44H66N12O7S2

MOLECULAR WEIGHT: 939.22

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [152274-67-4]

SYNONYMS:

RESEARCH AREA: Pain

CATEGORY: Acetalin »

REFERENCES:
C.T.Dooley et al., Proc. Natl. Acad. Sci. USA, 90, 10811 (1993)
1008) : ACTH (1-39), human
H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH (trifluoroacetate salt)
Pituitary hormone N-terminal synthetic fragment that stimulates glucocorticoid and mineralocorticoid synthesis and release in the adrenal cortex.

SEQUENCE: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

MOLECULAR FORMULA: C207H308N56O58S1

MOLECULAR WEIGHT: 4541.2

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [12279-41-3]

SYNONYMS:

RESEARCH AREA: Hormonal

CATEGORY: Adrenocorticotropic Hormones (ACTH) »

REFERENCES:
D. Yamashiro et al, JACS, 95, 1310 (1973)
N.Y. Ann. Acad. Sci., 297,1-641 (1977)
1009) : ACTH (18-39), human
H-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH (trifluoroacetate salt)
SEQUENCE: H-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: RPVKVYPNGAEDESAEAFPLEF

MOLECULAR FORMULA: C112H165N27O36

MOLECULAR WEIGHT: 2465.7

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [53917-42-3]

SYNONYMS:

RESEARCH AREA: Hormonal

CATEGORY: Adrenocorticotropic Hormones (ACTH) »

REFERENCES:
L.I. Larsson, Histochem., 55, 225 (1978)
1010) : ACTH (1-24), human
H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH (trifluoroacetate salt)
Pituitary hormone N-terminal synthetic fragment that stimulates the corticosteroid synthesis and secretion in the adrenal cortex. This peptide is more active than ACTH in terms of corticosteroid releasing activity in vitro.

SEQUENCE: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: SYSMEHFRWGKPVGKKRRPVKVYP

MOLECULAR FORMULA: C136H210N40O31S1

MOLECULAR WEIGHT: 2933.5

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [16960-16-0]

SYNONYMS:

RESEARCH AREA: Hormonal

CATEGORY: Adrenocorticotropic Hormones (ACTH) »

REFERENCES:
Y.F.Jacquet, Science, 201, 1032 (1978)
1011) : Fam-ACTH (1-24), human
Fam-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH (trifluoroacetate salt)
Pituitary hormone N-terminal synthetic fragment that stimulates the corticosteroid synthesis and secretion in the adrenal cortex. This peptide is more active than ACTH in terms of corticosteroid releasing activity in vitro.

SEQUENCE: Fam-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: Fam-SYSMEHFRWGKPVGKKRRPVKVYP

MOLECULAR FORMULA: C157H220N40O37S1

MOLECULAR WEIGHT: 3291.8

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [16960-16-0]

SYNONYMS:

RESEARCH AREA: Hormonal

CATEGORY: Adrenocorticotropic Hormones (ACTH) »

REFERENCES:
Y.F.Jacquet, Science, 201, 1032 (1978)
1012) : ACTH (6-24), human
H-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH (trifluoroacetate salt)
SEQUENCE: H-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: HFRWGKPVGKKRRPVKVYP

MOLECULAR FORMULA: C111H175N35O21

MOLECULAR WEIGHT: 2335.9

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS:

RESEARCH AREA: Hormonal

CATEGORY: Adrenocorticotropic Hormones (ACTH) »

REFERENCES:
1013) : ACTH (1-16), human
H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-OH (trifluoroacetate salt)
SEQUENCE: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: SYSMEHFRWGKPVGKK

MOLECULAR FORMULA: C89H133N25O22S1

MOLECULAR WEIGHT: 1937.3

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [5576-42-1]

SYNONYMS:

RESEARCH AREA: Hormonal

CATEGORY: Adrenocorticotropic Hormones (ACTH) »

REFERENCES:
1014) : ACTH (1-13), human
H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-OH (trifluoroacetate salt)
SEQUENCE: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: SYSMEHFRWGKPV

MOLECULAR FORMULA: C75H106N20O19S1

MOLECULAR WEIGHT: 1623.9

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [22006-64-0]

SYNONYMS:

RESEARCH AREA: Hormonal

CATEGORY: Adrenocorticotropic Hormones (ACTH) »

REFERENCES:
1015) : ACTH (1-10), human
H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-OH (trifluoroacetate salt)
SEQUENCE: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: SYSMEHFRWG

MOLECULAR FORMULA: C59H78N16O16S1

MOLECULAR WEIGHT: 1299.4

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [325553]

SYNONYMS:

RESEARCH AREA: Hormonal

CATEGORY: Adrenocorticotropic Hormones (ACTH) »

REFERENCES:
1016) : ACTH (4-10), human
H-Met-Glu-His-Phe-Arg-Trp-Gly-OH (trifluoroacetate salt)
SEQUENCE: H-Met-Glu-His-Phe-Arg-Trp-Gly-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: MEHFRWG

MOLECULAR FORMULA: C44H59N13O10S1

MOLECULAR WEIGHT: 962.1

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [780533]

SYNONYMS:

RESEARCH AREA: Hormonal

CATEGORY: Adrenocorticotropic Hormones (ACTH) »

REFERENCES:
R. Schwyzer et al., FEBS Letters, 19, 229 (1971)
1017) : ACTH (4-11), human
H-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-OH (trifluoroacetate salt)
SEQUENCE: H-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: MEHFRWGK

MOLECULAR FORMULA: C50H71N15O11S1

MOLECULAR WEIGHT: 1090.28

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [67224-41-3]

SYNONYMS:

RESEARCH AREA: Hormonal

CATEGORY: Adrenocorticotropic Hormones (ACTH) »

REFERENCES:
1018) : ACTH (1-17), human
H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH (trifluoroacetate salt)
SEQUENCE: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: SYSMEHFRWGKPVGKKR

MOLECULAR FORMULA: C95H145N29O23S1

MOLECULAR WEIGHT: 2093.5

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [7266-47-9]

SYNONYMS:

RESEARCH AREA: Hormonal

CATEGORY: Adrenocorticotropic Hormones (ACTH) »

REFERENCES:
1019) : N-Acetyl, ACTH (1-17), human
Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH (trifluoroacetate salt)
SEQUENCE: Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: Ac-SYSMEHFRWGKPVGKKR

MOLECULAR FORMULA: C97H147N29O24S1

MOLECULAR WEIGHT: 2135.5

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS:

RESEARCH AREA: Hormonal

CATEGORY: Adrenocorticotropic Hormones (ACTH) »

REFERENCES:
1020) : ACTH (1-39), rat
H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH (trifluoroacetate salt)
SEQUENCE: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF

MOLECULAR FORMULA: C210H315N57O57S1

MOLECULAR WEIGHT: 4582.3

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [77465-10-2]

SYNONYMS:

RESEARCH AREA: Hormonal

CATEGORY: Adrenocorticotropic Hormones (ACTH) »

REFERENCES:
J. Drouin, Nature, 288, 610 (1980)
E. Oates and E. Herbert, J. Biol. Chem., 259, 7421 (1984)
J. Drouin et al., FEBS Letters, 193, 54 (1985)
1021) : Corticostatin, human
H-Val-Cys-Ser-Cys-Arg-Leu-Val-Phe-Cys-Arg-Arg-Thr-Glu-Leu-Arg-Val-Gly-Asn-Cys-Leu-Ile-Gly-Gly-Val-Ser-Phe-Thr-Tyr-Cys-Cys-Thr-Arg-Val-OH (trifluoroacetate salt) (Cys2 and 30 bridge, Cys4 and 19 bridge, Cys9 and 29 bridge)
Human Neutrophil Peptide-4.

SEQUENCE: H-Val-Cys-Ser-Cys-Arg-Leu-Val-Phe-Cys-Arg-Arg-Thr-Glu-Leu-Arg-Val-Gly-Asn-Cys-Leu-Ile-Gly-Gly-Val-Ser-Phe-Thr-Tyr-Cys-Cys-Thr-Arg-Val-OH (trifluoroacetate salt)
(Cys2 and 30 bridge, Cys4 and 19 bridge, Cys9 and 29 bridge)

ONE-LETTER SEQUENCE: VCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRV (C2&C30 bridge, C4&C19 bridge, C9&C29 bridge)

MOLECULAR FORMULA: C157H255N49O43S6

MOLECULAR WEIGHT: 3709.5

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS:

RESEARCH AREA: Hormonal

CATEGORY: Adrenocorticotropic Hormones (ACTH) »

REFERENCES:
1022) : Corticostatin, rabbit
H-Gly-Ile-Cys-Ala-Cys-Arg-Arg-Arg-Phe-Cys-Pro-Asn-Ser-Glu-Arg-Phe-Ser-Gly-Tyr-Cys-Arg-Val-Asn-Gly-Ala-Arg-Tyr-Val-Arg-Cys-Cys-Ser-Arg-Arg-OH (trifluoroacetate salt) (Cys3 and 31 bridge, Cys5 and 20 bridge, Cys10 and 30 bridge)
Cationic arginine- and cysteine-rich peptide isolated from fetal and adult rabbit lung. Inhibitor of ACTH-stimulated corticosterone synthesis in rat adrenal cells in vitro.

SEQUENCE: H-Gly-Ile-Cys-Ala-Cys-Arg-Arg-Arg-Phe-Cys-Pro-Asn-Ser-Glu-Arg-Phe-Ser-Gly-Tyr-Cys-Arg-Val-Asn-Gly-Ala-Arg-Tyr-Val-Arg-Cys-Cys-Ser-Arg-Arg-OH (trifluoroacetate salt)
(Cys3 and 31 bridge, Cys5 and 20 bridge, Cys10 and 30 bridge)

ONE-LETTER SEQUENCE: GICACRRRFCPNSERFSGYCRVNGARYVRCCSRR (C3&C31 bridge,C5&C20 bridge,C10&C30 bridge)

MOLECULAR FORMULA: C163H259N63O44S6

MOLECULAR WEIGHT: 3997.7

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS:

RESEARCH AREA: Hormonal

CATEGORY: Adrenocorticotropic Hormones (ACTH) »

REFERENCES:
Q. Zhu et al., Proc. Natl. Acad. Sci. USA , 85, 592 (1988)
1023) : Acyl Carrier Protein (ACP) (65-74)
H-Val-Gln-Ala-Ala-Ile-Asp-Tyr-Ile-Asn-Gly-OH (trifluoroacetate salt)
A difficult peptide, synthesized for evaluating SPPS protocols.

SEQUENCE: H-Val-Gln-Ala-Ala-Ile-Asp-Tyr-Ile-Asn-Gly-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: VQAAIDYING

MOLECULAR FORMULA: C47H74N12O16

MOLECULAR WEIGHT: 1063.18

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [66851-75-0]

SYNONYMS:

RESEARCH AREA: Miscellaneous

CATEGORY: Acyl Carrier Protein (ACP) Fragments »

REFERENCES:
C. Arunan et al. Elsevier 56, 3005–3011 (2000)
1024) : ADP-Ribosylation Factor 6, ARF6 (2-13)
H-Gly-Lys-Val-Leu-Ser-Lys-Ile-Phe-Gly-Asn-Lys-Glu-OH (trifluoroacetate salt)
ADP-ribosylation factor (ARF) and ARF-like proteins are a family of highly conserved Ras-related GTPases.

SEQUENCE: H-Gly-Lys-Val-Leu-Ser-Lys-Ile-Phe-Gly-Asn-Lys-Glu-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: GKVLSKIFGNKE

MOLECULAR FORMULA: C60H102N16O17

MOLECULAR WEIGHT: 1319.6

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS:

RESEARCH AREA: Miscellaneous

CATEGORY: ADP-Ribosylation Factors (ARF) »

REFERENCES:
Matsukawa, J. et al. J. Biol. Chem. 278, 36470 (2003)
Galas, M-C. et al. J. Biol. Chem. 272, 2788 (1997)
Donaldson, JG. and RD. Klausner, Curr. Opin. Cell Biol. 6, 527 (1994)
1025) : Adrenomedullin (1-52), human
H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (trifluoroacetate salt) (Cys16 and 21 br
Participating hormone in blood pressure control that also elicits a potent and long lasting hypotensive effect.

SEQUENCE: H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (trifluoroacetate salt)
(Cys16 and 21 bridge)

ONE-LETTER SEQUENCE: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Cys16 and 21 bridge)

MOLECULAR FORMULA: C264H406N80O77S3

MOLECULAR WEIGHT: 6028.9

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [148498-78-6]

SYNONYMS:

RESEARCH AREA: Cardiovascular

CATEGORY: Adrenomedullins »

REFERENCES:
K. Kitamura et al., BBRC, 192, 533 (1993)
C. Nuki et al., BBRC, 196, 245 (1993)
1026) : Adrenomedullin (13-52), human
H-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (trifluoroacetate salt) (Cys4 and Cys9 bridge)
Possessor of vasodilatory activity and proposed modulator of receptor-mediated pulmonary vascular contraction by influence of Ca2+ influx. This fragment has also been suggested to be an endothelium-dependent vasodilator agent in pulmonary vascular bed in rats and a vascular phase modulator in inflammation.

SEQUENCE: H-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (trifluoroacetate salt)
(Cys4 and Cys9 bridge)

ONE-LETTER SEQUENCE: SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2(C4&C9 bridge)

MOLECULAR FORMULA: C200H308N58O59S2

MOLECULAR WEIGHT: 4533.17

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [154765-05-6]

SYNONYMS: Adrenomedullin (13-52) (human)

RESEARCH AREA: Cardiovascular, Inflammation

CATEGORY: Adrenomedullins »

REFERENCES:
Heaton, J. O. H. N., et al. American Journal of Physiology-Heart and Circulatory Physiology 268.6 (1995): H2211-H2215.
Sone, Masahiko, et al. Peptides 18.8 (1997): 1125-1129.
Hyman, Albert L., et al. American Journal of Physiology-Heart and Circulatory Physiology 43.4 (1998): H1218.
Gumusel, Bulent, et al. American Journal of Physiology-Heart and Circulatory Physiology 274.4 (1998): H1255-H1263.
Chu, Duc Quyen, et al. British journal of pharmacology 130.7 (2000): 1589-1596.
1027) : Adrenomedullin (22-52), human
H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (trifluoroacetate salt)
Adrenomedullin-elicted cAMP antagonist and a more effective inhibitor than alpha-CGRP in terms of adrenomedullin- and CGRP-specific receptors.

SEQUENCE: H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (trifluoroacetate salt)

ONE-LETTER SEQUENCE: TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2

MOLECULAR FORMULA: C159H252N46O48

MOLECULAR WEIGHT: 3576.1

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS:

RESEARCH AREA: Cardiovascular

CATEGORY: Adrenomedullins »

REFERENCES:
1028) : Adrenomedullin (1-12), human
H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-OH (trifluoroacetate salt)
SEQUENCE: H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: YRQSMNNFQGLR

MOLECULAR FORMULA: C64H100N22O19S1

MOLECULAR WEIGHT: 1513.7

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS:

RESEARCH AREA: Cardiovascular

CATEGORY: Adrenomedullins »

REFERENCES:
1029) : Pro-Adrenomedullin (N-20), human
H-Ala-Arg-Leu-Asp-Val-Ala-Ser-Glu-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2 (trifluoroacetate salt)
Precursor of adrenomedullin containing proadrenomedullin NH2-terminal 20 peptide (PAMP), a unique 20-residue sequence. When administered, PAMP produces a strong and rapid hypotensive effect in anesthetized rats. PAMP has also been suggested to function as an inhibitory modulator of renal noradrenergic neurotransmission, thereby playing an important role in the regulation of renal functions. PAMP has been proposed to serve as an inhibitory regulator in adrenal catecholamine release in vivo and possesses a potent hyperglycemic effect after intra-third cerebroventricular administration in fasted mice.

SEQUENCE: H-Ala-Arg-Leu-Asp-Val-Ala-Ser-Glu-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2 (trifluoroacetate salt)

ONE-LETTER SEQUENCE: ARLDVASEFRKKWNKWALSR-NH2

MOLECULAR FORMULA: C112H178N36O27

MOLECULAR WEIGHT: 2460.9

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [150238-87-2]

SYNONYMS:

RESEARCH AREA: Cardiovascular

CATEGORY: Adrenomedullins »

REFERENCES:
K. Kitamura et al., BBRC, 194, 720 (1993)
1030) : Pro-Adrenomedullin (45-92), human
H-Glu-Leu-Arg-Met-Ser-Ser-Ser-Tyr-Pro-Thr-Gly-Leu-Ala-Asp-Val-Lys-Ala-Gly-Pro-Ala-Gln-Thr-Leu-Ile-Arg-Pro-Gln-Asp-Met-Lys-Gly-Ala-Ser-Arg-Ser-Pro-Glu-Asp-Ser-Ser-Pro-Asp-Ala-Ala-Arg-Ile-Arg-Val-OH (trifluoroacetate salt)
The adrenomedullin (ADM) precursor fragment is used in diagnosing several disease states, such as the dysfunction of the cardiovascular system and sepsis. The released amounts of these peptides is a reflection of the stoichiometric generation of ADM and proADM. ADM cannot be easily determined directly, because of the masking by binding proteins, instability in serum and stickiness to surfaces.

SEQUENCE: H-Glu-Leu-Arg-Met-Ser-Ser-Ser-Tyr-Pro-Thr-Gly-Leu-Ala-Asp-Val-Lys-Ala-Gly-Pro-Ala-Gln-Thr-Leu-Ile-Arg-Pro-Gln-Asp-Met-Lys-Gly-Ala-Ser-Arg-Ser-Pro-Glu-Asp-Ser-Ser-Pro-Asp-Ala-Ala-Arg-Ile-Arg-Val-OH (trifluoroacetate salt)

ONE-LETTER SEQUENCE: ELRMSSSYPTGLADVKAGPAQTLIRPQDMKGASRSPEDSSPDAARIRV

MOLECULAR FORMULA: C215H359N67O73S2

MOLECULAR WEIGHT: 5114.8

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [166798-69-2]

SYNONYMS:

RESEARCH AREA: Cardiovascular

CATEGORY: Adrenomedullins »

REFERENCES:
J.Struck et al., Peptides , 25, 1369 (2004)
1031) : Adrenomedullin (1-50), rat
H-Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (trifluoroacetate salt) (Cys14 and 19 bridge)
Elicitor of potent platelet cAMP elevating activity and vasodepressor effect on rats.

SEQUENCE: H-Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (trifluoroacetate salt)
(Cys14 and 19 bridge)

ONE-LETTER SEQUENCE: YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Cys14 and 19 bridge)

MOLECULAR FORMULA: C248H381N77O75S5

MOLECULAR WEIGHT: 5729.5

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [159964-38-2]

SYNONYMS:

RESEARCH AREA: Cardiovascular

CATEGORY: Adrenomedullins »

REFERENCES:
J. Sakata et al., BBRC, 195, 921 (1993)
1032) : Adrenomedullin (11-50), rat
H-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (trifluoroacetate salt) (Cys4 and 9 bridge)
C-terminal fragment found to induce dose-dependent and endothelium-independent vasodilatation on arterial mesenteric vasculator, though inactive on the venous side of tested rat perfused mesentric bed. This peptide thus shares similar properties to those of CGRP (human)

SEQUENCE: H-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (trifluoroacetate salt)
(Cys4 and 9 bridge)

ONE-LETTER SEQUENCE: STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Cys4 and 9 bridge)

MOLECULAR FORMULA: C194H304N58O59S4

MOLECULAR WEIGHT: 4521.17

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER: [163648-32-6]

SYNONYMS: Adrenomedullin (11-50) (rat)

RESEARCH AREA: Cardiovascular, Hormonal

CATEGORY: Adrenomedullins »

REFERENCES:
N.Berthiaume et al., Can. J. Physiol. Pharmacol., 73, 1080 (1995)
A.M.Elhawary et al., Br. J. Pharmacol., 115, 1133 (1995)
1033) : Pro-Adrenomedullin (N-20), rat H-Ala-Arg-Leu-Asp-Thr-Ser-Ser-Gln-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2 (trifluoroacetate salt)
H-Ala-Arg-Leu-Asp-Thr-Ser-Ser-Gln-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2 (trifluoroacetate salt)
Prodepin, rat. Biological activity still unknown. High possibility that it is synthesized in vivo and holds some important physiological function.

SEQUENCE: H-Ala-Arg-Leu-Asp-Thr-Ser-Ser-Gln-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2 (trifluoroacetate salt)

ONE-LETTER SEQUENCE: ARLDTSSQFRKKWNKWALSR-NH2

MOLECULAR FORMULA: C111H177N37O28

MOLECULAR WEIGHT: 2477.9

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS:

RESEARCH AREA: Cardiovascular

CATEGORY: Adrenomedullins »

REFERENCES:
J. Sakata et al., BBRC, 195, 921 (1993)
1034) : Adrenomedullin (1-52), porcine
H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (trifluoroacetate salt) (Cys16 and 21 br
Participating hormone in blood pressure control that also elicits a potent and long lasting hypotensive effect.

SEQUENCE: H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (trifluoroacetate salt)
(Cys16 and 21 bridge)

ONE-LETTER SEQUENCE: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 (Cys16 and 21 bridge)

MOLECULAR FORMULA: C262H403N79O76S3

MOLECULAR WEIGHT: 5971.8

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS:

RESEARCH AREA: Cardiovascular

CATEGORY: Adrenomedullins »

REFERENCES:
1035) : Pro-Adrenomedullin (N-20), porcine
H-Ala-Arg-Leu-Asp-Val-Ala-Ala-Glu-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2 (trifluoroacetate salt)
Prodepin, porcine.

SEQUENCE: H-Ala-Arg-Leu-Asp-Val-Ala-Ala-Glu-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2 (trifluoroacetate salt)

ONE-LETTER SEQUENCE: ARLDVAAEFRKKWNKWALSR-NH2

MOLECULAR FORMULA: C112H178N36O26

MOLECULAR WEIGHT: 2444.9

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS:

RESEARCH AREA: Cardiovascular

CATEGORY: Adrenomedullins »

REFERENCES:
1036) : Agouti-related Protein (AGRP) (83-132) Amide (human)
H-Ser-Ser-Arg-Arg-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr-NH2 (trifluoroacetate salt) (Cys5-20/Cys12-26/Cys19-
SEQUENCE: H-Ser-Ser-Arg-Arg-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr-NH2 (trifluoroacetate salt)
(Cys5-20/Cys12-26/Cys19-37/Cys23-47/Cys28-35 Bridge)

ONE-LETTER SEQUENCE: SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 (Cys5 and 20 bridge, Cys12 and 26 bridge, Cys19 and 37 bridge, Cys23 and 47 bridge, Cys28 and 35 bridge)

MOLECULAR FORMULA: C235H362N76O67S11

MOLECULAR WEIGHT: 5676.6

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS:

RESEARCH AREA: Obesity

CATEGORY: Agouti-Related Proteins »

REFERENCES:
1037) : Agouti-related Protein (AGRP) (87-132) human, acetyl
Ac-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr-OH (trifluoroacetate salt) (Cys1-16/Cys8-22/Cys15-33/Cys19-43/Cys24
SEQUENCE: Ac-Cys-Val-Arg-Leu-His-Glu-Ser-Cys-Leu-Gly-Gln-Gln-Val-Pro-Cys-Cys-Asp-Pro-Cys-Ala-Thr-Cys-Tyr-Cys-Arg-Phe-Phe-Asn-Ala-Phe-Cys-Tyr-Cys-Arg-Lys-Leu-Gly-Thr-Ala-Met-Asn-Pro-Cys-Ser-Arg-Thr-OH (trifluoroacetate salt)
(Cys1-16/Cys8-22/Cys15-33/Cys19-43/Cys24-31 Bridge)

ONE-LETTER SEQUENCE: Ac-CVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT (Cys1 and 16 bridge, Cys8 and 22 bridge, Cys15 and 33 bridge, Cys19 and 43 bridge, Cys24 and 31 bridge)

MOLECULAR FORMULA: C219H339N65O63S11

MOLECULAR WEIGHT: 5233.1

STORAGE CONDITIONS: -20 ± 5 °C

CAS REGISTRY NUMBER:

SYNONYMS:

RESEARCH AREA: Obesity

CATEGORY: Agouti-Related Proteins »

REFERENCES:


CALL 1-800-301-6268
1-703-870-7691(intl)
FAX: 1-703-637-9863
EMAIL: order@peptide2.com

Why Peptide 2.0 Inc.:
From $2.0 per amino acid residue (aa)
High Quality with Unbeatable Low Price
Real-time tracking your order status
Two to Three weeks delivery time for most peptides.
Try our risk-free service now! You won't be charged unless you receive your peptides.

peptide synthesis quote
peptide synthesis order

Quote | Order | Tools | Calculator | Applications | Resources | Knowledge | FAQ | Terms & Conditions | Privacy Notice | Contact

COPYRIGHT ©2019 PEPTIDE 2.0 INCORPORATED